Recombinant Mouse Tyrosinase (Tyr)

Catalog Number: CSB-CF025394MO
Article Name: Recombinant Mouse Tyrosinase (Tyr)
Biozol Catalog Number: CSB-CF025394MO
Supplier Catalog Number: CSB-CF025394MO
Alternative Catalog Number: CSB-CF025394MO-100, CSB-CF025394MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (Albino locus protein)(Monophenol monooxygenase),CSB-PR2024
Molecular Weight: 61.3 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P11344
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 19-533aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: HFPRACASSKNLLAKECCPPWMGDGSPCGQLSGRGSCQDILLSSAPSGPQFPFKGVDDRESWPSVFYNRTCQCSGNFMGFNCGNCKFGFGGPNCTEKRVLIRRNIFDLSVSEKNKFFSYLTLAKHTISSVYVIPTGTYGQMNNGSTPMFNDINIYDLFVWMHYYVSRDTLLGGSEIWRDIDFAHEAPGFLPWHRLFLLLWEQEIRELTGDENFTVPYWDWRDAENCDICTDEYLGGRHPENPNLLSPASFFSSW