Recombinant Human Nucleolar transcription factor 1 (UBTF)
Catalog Number:
CSB-CF025524HU
- Images (0)
| Article Name: | Recombinant Human Nucleolar transcription factor 1 (UBTF) |
| Biozol Catalog Number: | CSB-CF025524HU |
| Supplier Catalog Number: | CSB-CF025524HU |
| Alternative Catalog Number: | CSB-CF025524HU-100, CSB-CF025524HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Autoantigen NOR-90 Upstream-binding factor 1 Short name:UBF-1 |
| Molecular Weight: | 93.4 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P17480 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-764aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDATTKEVKDSLGKQWSQLSDKKRLKWIHKALEQRK |
Product Guarantee and Expert Support
