Recombinant Human UDP-glucuronosyltransferase 1A5 (UGT1A5)

Catalog Number: CSB-CF025578HU
Article Name: Recombinant Human UDP-glucuronosyltransferase 1A5 (UGT1A5)
Biozol Catalog Number: CSB-CF025578HU
Supplier Catalog Number: CSB-CF025578HU
Alternative Catalog Number: CSB-CF025578HU-100, CSB-CF025578HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: UGT1A5,UDP-glucuronosyltransferase 1-5,UDPGT 1-5,UGT1-05,UDP-glucuronosyltransferase 1-E,UGT-1E,UGT1E
Molecular Weight: 58.6 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P35504
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 29-534aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GKVLVVPTDGSHWLSMREALRDLHARGHQVVVLTLEVNMYIKEENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNMSLIIHRSCVELLHNEALIRHLHATSFDVVLTDPFHLCAAVLAKYLSIPAVFFLRNIPCDLDFKGTQCPNPSSYIPRLLTTNSDHMTFLQRVKNMLYPLALSYLCHAVSAPYASLASELFQREVSVVDLVSHASVWLFRGDFVMDYPRPIMPNMVFIGGINCA