Recombinant Human Apolipoprotein A-I (APOA1), partial
Catalog Number:
CSB-CF2066
- Images (0)
| Article Name: | Recombinant Human Apolipoprotein A-I (APOA1), partial |
| Biozol Catalog Number: | CSB-CF2066 |
| Supplier Catalog Number: | CSB-CF2066 |
| Alternative Catalog Number: | CSB-CF2066-100, CSB-CF2066-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Apo-AI,ApoA-I,Apolipoprotein A1,ProapoA-I,Apolipoprotein A-I1-242 |
| Molecular Weight: | 25.0 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P02647 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 79-267aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | STFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ |
Product Guarantee and Expert Support
