Recombinant Rice Helix-loop-helix DNA-binding domain containing protein, expressed (LOC_Os11g32100)
Catalog Number:
CSB-CF2220OGF
- Images (0)
| Article Name: | Recombinant Rice Helix-loop-helix DNA-binding domain containing protein, expressed (LOC_Os11g32100) |
| Biozol Catalog Number: | CSB-CF2220OGF |
| Supplier Catalog Number: | CSB-CF2220OGF |
| Alternative Catalog Number: | CSB-CF2220OGF-100, CSB-CF2220OGF-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | / |
| Molecular Weight: | 69.5 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | Q2R3F6 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-524aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MLPRFHGAMWMQDDGGGDQEHGQAAPPGQEQHHHDQHLMALAAAAAGGAGFGAAQAPAPLLDEDWYFDAAGGGGGGAHGSMMLGLSSVHGGIGAGTSGGGHGQQFSLLNMGAAAAPFDVSGFDLGIACGGVGGGGDVVSFLGGGNASNTALLPVGNAGFLGTFGGFGTAASQMPEFGGLAGFDMFDAGAVNTGGSSSSSSAAAAAASASAHVSNTAPFSGRGKAAVLRPLDIVPPVGAQPTLFQKRALRRNAGE |
Product Guarantee and Expert Support
