Recombinant Staphylococcus aureus Enterotoxin type I (SEI)
Catalog Number:
CSB-CF2248FKZ
- Images (0)
| Article Name: | Recombinant Staphylococcus aureus Enterotoxin type I (SEI) |
| Biozol Catalog Number: | CSB-CF2248FKZ |
| Supplier Catalog Number: | CSB-CF2248FKZ |
| Alternative Catalog Number: | CSB-CF2248FKZ-100, CSB-CF2248FKZ-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | sei |
| Molecular Weight: | 47.9 kDa |
| Tag: | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| UniProt: | O85383 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-242aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MKKFKYSFILVFILLFNIKDLTYAQGDIGVGNLRNFYTKHDYIDLKGVTDKNLPIANQLEFSTGTNDLISESNNWDEISKFKGKKLDIFGIDYNGPCKSKYMYGGATLSGQYLNSARKIPINLWVNGKHKTISTDKIATNKKLVTAQEIDVKLRRYLQEEYNIYGHNNTGKGKEYGYKSKFYSGFNNGKVLFHLNNEKSFSYDLFYTGDGLPVSFLKIYEDNKIIESEKFHLDVEISYVDSN |
Product Guarantee and Expert Support
