Recombinant Gorilla gorilla gorilla Fibroblast growth factor

Catalog Number: CSB-CF2954GKM
Article Name: Recombinant Gorilla gorilla gorilla Fibroblast growth factor
Biozol Catalog Number: CSB-CF2954GKM
Supplier Catalog Number: CSB-CF2954GKM
Alternative Catalog Number: CSB-CF2954GKM-100, CSB-CF2954GKM-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: FGF,CSB-PR2024
Molecular Weight: 22.2 kDa
Tag: N-terminal 10xHis-tagged
UniProt: G3QFY8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 29-209aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS