Recombinant Human G protein-coupled receptor 20 variant
Catalog Number:
CSB-CF3008HU
- Images (0)
| Article Name: | Recombinant Human G protein-coupled receptor 20 variant |
| Biozol Catalog Number: | CSB-CF3008HU |
| Supplier Catalog Number: | CSB-CF3008HU |
| Alternative Catalog Number: | CSB-CF3008HU-100, CSB-CF3008HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | /,CSB-PR2024 |
| Molecular Weight: | 35.8 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | Q59GP3 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-273aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | TPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHH |
Product Guarantee and Expert Support
