Recombinant Avian infectious bronchitis virus Spike glycoprotein (S), partial

Catalog Number: CSB-CF321003ARV
Article Name: Recombinant Avian infectious bronchitis virus Spike glycoprotein (S), partial
Biozol Catalog Number: CSB-CF321003ARV
Supplier Catalog Number: CSB-CF321003ARV
Alternative Catalog Number: CSB-CF321003ARV-100, CSB-CF321003ARV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (S glycoprotein)(E2)(Peplomer protein),CSB-PR2024
Molecular Weight: 26.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P12650
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: in vitro E.coli expression system
Expression System: 317-537aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ESNFMYGSYHPSCSFRLETINNGLWFNSLSVSIAYGPLQGGCKQSVFSGRATCCYAYSYGGPLLCKGVYSGELDHNFECGLLVYVTKSGGSRIQTATEPPVITQHNYNNITLNTCVDYNIYGRIGQGFITNVTDSAVSYNYLADAGLAILDTSGSIDIFVVQSEYGLNYYKVNPCEDVNQQFVVSGGKLVGILTSRNETGSQLLENQFYIKITNGTRRFRR