Recombinant Human cytomegalovirus Uncharacterized protein UL131 (UL131)
Catalog Number:
CSB-CF323723HWV
- Images (0)
| Article Name: | Recombinant Human cytomegalovirus Uncharacterized protein UL131 (UL131) |
| Biozol Catalog Number: | CSB-CF323723HWV |
| Supplier Catalog Number: | CSB-CF323723HWV |
| Alternative Catalog Number: | CSB-CF323723HWV-100, CSB-CF323723HWV-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | UL131Uncharacterized protein UL131 |
| Molecular Weight: | 24.2 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | P16773 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-76aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MCMMSHNKAFFLSLQHAAVSGVAVCLSVRRGAGSVPAGNRGKKTIITEYRITGTRALARCPTKPVTSMWNSSWTSR |
Product Guarantee and Expert Support
