Recombinant Rhodococcus erythropolis SK121 Stearoyl-CoA 9-desaturase (RHOER0001_5437)
Catalog Number:
CSB-CF3298GMS
- Images (0)
| Article Name: | Recombinant Rhodococcus erythropolis SK121 Stearoyl-CoA 9-desaturase (RHOER0001_5437) |
| Biozol Catalog Number: | CSB-CF3298GMS |
| Supplier Catalog Number: | CSB-CF3298GMS |
| Alternative Catalog Number: | CSB-CF3298GMS-100, CSB-CF3298GMS-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | /,CSB-PR2024 |
| Molecular Weight: | 45.6 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | C3JU82 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-390aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MFGLSLPTLPFLGNGSDAKDDAPVVLTYEQVEEIGRELDALRDRTVASLGAEDREYIYKIIKAQRGFEVAGRGLMYLGFLPPVWLAAVGALSVSKILDNMEIGHNVMHGQYDWMREPGLNSEVFEWDTVCPADQWRHSHNYMHHTYTNILGKDRDIGYGILRIDDAQKWNPYYLGNPVWAFALMVLFEWGVMMHDLEIENVIQGKRKWHDVKPLLKGWWNKAGKQVLKDYVIFPVLTGPLFVTTLAGNVTANLV |
Product Guarantee and Expert Support
