Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE (yopE)
Catalog Number:
CSB-CF330087YAQA2
- Images (0)
| Article Name: | Recombinant Yersinia enterocolitica Outer membrane virulence protein YopE (yopE) |
| Biozol Catalog Number: | CSB-CF330087YAQA2 |
| Supplier Catalog Number: | CSB-CF330087YAQa2 |
| Alternative Catalog Number: | CSB-CF330087YAQA2-100, CSB-CF330087YAQA2-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | yopE, yop25, Outer membrane virulence protein YopE |
| Molecular Weight: | 38.9 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | P31492 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | in vitro E.coli expression system |
| Expression System: | 1-219aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM |
Product Guarantee and Expert Support
