Recombinant Human PCNA-associated factor (PCLAF)

Catalog Number: CSB-EP012164HU
Article Name: Recombinant Human PCNA-associated factor (PCLAF)
Biozol Catalog Number: CSB-EP012164HU
Supplier Catalog Number: CSB-EP012164HU
Alternative Catalog Number: CSB-EP012164HU-1,CSB-EP012164HU-100,CSB-EP012164HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Hepatitis C virus NS5A-transactivated protein 9 ,HCV NS5A-transactivated protein 9Overexpressed in anaplastic thyroid carcinoma 1 ,OEATC-1,PCNA-associated factor of 15KDA ,PAF15 ,p15PAF
Molecular Weight: 39 kDa
Tag: N-terminal GST-tagged
UniProt: Q15004
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-111aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.