Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Biotinylated

Catalog Number: CSB-EP023924HU-B
Article Name: Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Biotinylated
Biozol Catalog Number: CSB-EP023924HU-B
Supplier Catalog Number: CSB-EP023924HU-B
Alternative Catalog Number: CSB-EP023924HU-B-1, CSB-EP023924HU-B-100, CSB-EP023924HU-B-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Serine protease 10,CSB-PR2024
Molecular Weight: 90.6 kDa
Tag: N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
UniProt: O15393
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 106-492aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND