Recombinant Escherichia coli Peptidoglycan-associated lipoprotein (pal), Biotinylated
Catalog Number:
CSB-EP359227EOD-B
- Images (0)
| Article Name: | Recombinant Escherichia coli Peptidoglycan-associated lipoprotein (pal), Biotinylated |
| Biozol Catalog Number: | CSB-EP359227EOD-B |
| Supplier Catalog Number: | CSB-EP359227EOD-B |
| Alternative Catalog Number: | CSB-EP359227EOD-B-1, CSB-EP359227EOD-B-100, CSB-EP359227EOD-B-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (PAL),CSB-PR2024 |
| Molecular Weight: | 64.4 kDa |
| Tag: | N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged |
| UniProt: | P0A913 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 22-173aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | CSSNKNASNDGSEGMLGAGTGMDANGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY |
Product Guarantee and Expert Support
