Recombinant Escherichia coli O157:H7 Cell division protein FtsZ (ftsZ)

Product Overview

• Article Name: Recombinant Escherichia coli O157:H7 Cell division protein FtsZ (ftsZ)
• Biozol Catalog Number: CSB-EP359271EOD
• Supplier Catalog Number: CSB-EP359271EOD
• Alternative Catalog Number: CSB-EP359271EOD-1, CSB-EP359271EOD-100, CSB-EP359271EOD-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: Cell division protein FtsZ

Product Properties

• Molecular Weight: 47.8 kDa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• UniProt: P0A9A8
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Expression System: 1-383aa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDL