Recombinant Salmonella enteritidis Cold shock protein CspA (cspA)
Catalog Number:
CSB-EP359368SBG
- Images (0)
| Article Name: | Recombinant Salmonella enteritidis Cold shock protein CspA (cspA) |
| Biozol Catalog Number: | CSB-EP359368SBG |
| Supplier Catalog Number: | CSB-EP359368SBG |
| Alternative Catalog Number: | CSB-EP359368SBG-1, CSB-EP359368SBG-100, CSB-EP359368SBG-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | 7.4 kDa cold shock protein CS7.4 |
| Molecular Weight: | 14.7 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P0A9Y5 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 2-70aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL |
Product Guarantee and Expert Support
