Recombinant Escherichia coli Thioredoxin-1 (trxA)
Catalog Number:
CSB-EP359388ENV
- Images (0)
| Article Name: | Recombinant Escherichia coli Thioredoxin-1 (trxA) |
| Biozol Catalog Number: | CSB-EP359388ENV |
| Supplier Catalog Number: | CSB-EP359388ENV |
| Alternative Catalog Number: | CSB-EP359388ENV-1, CSB-EP359388ENV-100, CSB-EP359388ENV-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | trxA, fipA, tsnC, b3781, JW5856, Thioredoxin 1, Trx-1 |
| Molecular Weight: | 15.7 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P0AA25 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 2-109aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA |
Product Guarantee and Expert Support
