Recombinant Escherichia coli O157:H7 DNA-binding protein HU-alpha (hupA)

Catalog Number: CSB-EP359761EOD
Article Name: Recombinant Escherichia coli O157:H7 DNA-binding protein HU-alpha (hupA)
Biozol Catalog Number: CSB-EP359761EOD
Supplier Catalog Number: CSB-EP359761EOD
Alternative Catalog Number: CSB-EP359761EOD-1, CSB-EP359761EOD-100, CSB-EP359761EOD-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: HU-2 NS2
Molecular Weight: 25.5 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P0ACF2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-90aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK