Recombinant Escherichia coli DNA-binding protein H-NS (hns)
Catalog Number:
CSB-EP359764ENV
- Images (0)
| Article Name: | Recombinant Escherichia coli DNA-binding protein H-NS (hns) |
| Biozol Catalog Number: | CSB-EP359764ENV |
| Supplier Catalog Number: | CSB-EP359764ENV |
| Alternative Catalog Number: | CSB-EP359764ENV-1, CSB-EP359764ENV-100, CSB-EP359764ENV-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Heat-stable nucleoid-structuring protein (Histone-like protein HLP-II) (Protein B1) (Protein H1) (bglY) (cur) (drdX) (hnsA) (msyA) (osmZ) (pilG) (topS) |
| Molecular Weight: | 19.5 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P0ACF8 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 2-137aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQYREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIKKAMDEQGKSLDDFLIKQ |
Product Guarantee and Expert Support
