Recombinant Streptococcus equi subsp. zooepidemicus IgG endopeptidase (ideZ)
Catalog Number:
CSB-EP3597GOM
- Images (0)
| Article Name: | Recombinant Streptococcus equi subsp. zooepidemicus IgG endopeptidase (ideZ) |
| Biozol Catalog Number: | CSB-EP3597GOM |
| Supplier Catalog Number: | CSB-EP3597GOM |
| Alternative Catalog Number: | CSB-EP3597GOM-1, CSB-EP3597GOM-100, CSB-EP3597GOM-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | ,CSB-PR2024 |
| Molecular Weight: | 37.3 kDa |
| Tag: | C-terminal 12xHis-tagged |
| UniProt: | Q0PIW1 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 35-349aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | DDYQRNAAEVYAKEVPHQITSVWTKGVTPLTPEQFRYNNEDVIHAPYLAHQGWYDITKVFDGKDNLLCGAATAGNMLHWWFDQNKTEIEAYLSKHPEKQKIIFNNQELFDLKAAIDTKDSQTNSQLFNYFRDKAFPNLSARQLGVMPDLVLDMFINGYYLNVFKTQSTDVNRPYQDKDKRGGIFDAVFTRGDQTTLLTARHDLKNKGLNDISTIIKQELTEGRALALSHTYANVSISHVINLWGADFNAEGNLE |
Product Guarantee and Expert Support
