Recombinant Escherichia coli Lipopolysaccharide export system protein lptA (lptA)
Catalog Number:
CSB-EP360010ENV
- Images (0)
| Article Name: | Recombinant Escherichia coli Lipopolysaccharide export system protein lptA (lptA) |
| Biozol Catalog Number: | CSB-EP360010ENV |
| Supplier Catalog Number: | CSB-EP360010ENV |
| Alternative Catalog Number: | CSB-EP360010ENV-1, CSB-EP360010ENV-100, CSB-EP360010ENV-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | lptA, yhbN, b3200, JW3167, Lipopolysaccharide export system protein LptA,CSB-PR2024 |
| Molecular Weight: | 33.3 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | P0ADV1 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 28-185aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN |
Product Guarantee and Expert Support
