Recombinant Human Urokinase-type plasminogen activator (PLAU)
Catalog Number:
CSB-EP360437HU
- Images (0)
| Article Name: | Recombinant Human Urokinase-type plasminogen activator (PLAU) |
| Biozol Catalog Number: | CSB-EP360437HU |
| Supplier Catalog Number: | CSB-EP360437HU |
| Alternative Catalog Number: | CSB-EP360437HU-1, CSB-EP360437HU-100, CSB-EP360437HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | ATF, ATF uPA, BDPLT5, Plasminogen activator, Plasminogen activator urinary, Plasminogen activator urokinase, PLAU, QPD, u PA, U plasminogen activator, u-PA, U-plasminogen activator, uPA, URK, UROK_HUMAN, Urokinase plasminogen activator, Urokinase type pl |
| Molecular Weight: | 52.4 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P00749 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 21-431aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHN |
Product Guarantee and Expert Support
