Recombinant Escherichia coli Signal peptidase I (lepB), partial

Catalog Number: CSB-EP360447ENV
Article Name: Recombinant Escherichia coli Signal peptidase I (lepB), partial
Biozol Catalog Number: CSB-EP360447ENV
Supplier Catalog Number: CSB-EP360447ENV
Alternative Catalog Number: CSB-EP360447ENV-1, CSB-EP360447ENV-100, CSB-EP360447ENV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Leader peptidase I
Molecular Weight: 43.7 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P00803
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 78-324aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDKQEGEWPTGLRLSRIGGIH