Recombinant Saccharomyces cerevisiae GTP-binding protein YPT1 (YPT1)
Catalog Number:
CSB-EP360492SVG
- Images (0)
| Article Name: | Recombinant Saccharomyces cerevisiae GTP-binding protein YPT1 (YPT1) |
| Biozol Catalog Number: | CSB-EP360492SVG |
| Supplier Catalog Number: | CSB-EP360492SVG |
| Alternative Catalog Number: | CSB-EP360492SVG-1, CSB-EP360492SVG-100, CSB-EP360492SVG-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Protein YP2 Rab GTPase YPT1 Transport GTPase YPT1 |
| Molecular Weight: | 39.2 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | P01123 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-206aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC |
Product Guarantee and Expert Support
