Recombinant DT3C (Diphtheria toxin & spg 3C domain) for Antibody Internalization Assay

Catalog Number: CSB-EP360556CQR1
Article Name: Recombinant DT3C (Diphtheria toxin & spg 3C domain) for Antibody Internalization Assay
Biozol Catalog Number: CSB-EP360556CQR1
Supplier Catalog Number: CSB-EP360556CQR1
Alternative Catalog Number: CSB-EP360556CQR1-1, CSB-EP360556CQR1-100, CSB-EP360556CQR1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 69.4 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P00588
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 33-417aa(P00588) & 291-497aa(P19909)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRRSVGSSLSCINLDWDVIRDKTKTKIESLKEHGPIKNKMSESPNKTVSEEKAKQYLEEFHQTA