Recombinant Schmidtea mediterranea Activin 2, partial
Catalog Number:
CSB-EP3606GOQ1
- Images (0)
| Article Name: | Recombinant Schmidtea mediterranea Activin 2, partial |
| Biozol Catalog Number: | CSB-EP3606GOQ1 |
| Supplier Catalog Number: | CSB-EP3606GOQ1 |
| Alternative Catalog Number: | CSB-EP3606GOQ1-1, CSB-EP3606GOQ1-100, CSB-EP3606GOQ1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Activin 2(Fragment) |
| Molecular Weight: | 42.9 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | U3RAB9 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 64-406aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | NPVERKSSVYNDNAEEKIIQKDSFKDKVINDLKSKILQKLNLKEAPKFNSSFDWSSMTEQIRSAALRLGVPFDETTENSQPTSESMIISLTKVNHCIDNSTNNQHCYDLTIPNMDNKILVGANFIIQFLPLAFERTVEDNIIYNITINNLPETVYSFSVAQLKSNSLYIAYTNILKTLLDNQRMSHSTFSFTVSISGDEQTTKLERMIDIENIVIELEYQVLPTPVRKRRDAGNTCIPNTYFCCTQTLKVGIDE |
Product Guarantee and Expert Support
