Recombinant Staphylococcus aureus Enterotoxin type B (entB)
Catalog Number:
CSB-EP360703FKZ
- Images (0)
| Article Name: | Recombinant Staphylococcus aureus Enterotoxin type B (entB) |
| Biozol Catalog Number: | CSB-EP360703FKZ |
| Supplier Catalog Number: | CSB-EP360703FKZ |
| Alternative Catalog Number: | CSB-EP360703FKZ-1, CSB-EP360703FKZ-100, CSB-EP360703FKZ-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | SEB |
| Molecular Weight: | 55.4 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | P01552 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 28-266aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK |
Product Guarantee and Expert Support
