Recombinant Vibrio cholerae serotype O1 Cholera enterotoxin subunit B (ctxB)
Catalog Number:
CSB-EP360704VEX
- Images (0)
| Article Name: | Recombinant Vibrio cholerae serotype O1 Cholera enterotoxin subunit B (ctxB) |
| Biozol Catalog Number: | CSB-EP360704VEX |
| Supplier Catalog Number: | CSB-EP360704VEX |
| Alternative Catalog Number: | CSB-EP360704VEX-1, CSB-EP360704VEX-100, CSB-EP360704VEX-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Cholera enterotoxin B chain Cholera enterotoxin gamma chain Choleragenoid,CSB-PR2024 |
| Molecular Weight: | 15.6 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P01556 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 22-124aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN |
Product Guarantee and Expert Support
