Recombinant Human Interferon alpha-2 (IFNA2)
Catalog Number:
CSB-EP360706HUE3
- Images (0)
| Article Name: | Recombinant Human Interferon alpha-2 (IFNA2) |
| Biozol Catalog Number: | CSB-EP360706HUE3 |
| Supplier Catalog Number: | CSB-EP360706HUe3 |
| Alternative Catalog Number: | CSB-EP360706HUE3-1, CSB-EP360706HUE3-100, CSB-EP360706HUE3-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (IFN-alpha-2)(Interferon alpha-A)(LeIF A),CSB-PR2024 |
| Molecular Weight: | 34.6 kDa |
| Tag: | N-terminal 6xHis-KSI-tagged |
| UniProt: | P01563 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 24-188aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Product Guarantee and Expert Support
