Recombinant Mouse H-2 class I histocompatibility antigen, K-B alpha chain (H2-K1),partial

Catalog Number: CSB-EP360792MO
Article Name: Recombinant Mouse H-2 class I histocompatibility antigen, K-B alpha chain (H2-K1),partial
Biozol Catalog Number: CSB-EP360792MO
Supplier Catalog Number: CSB-EP360792MO
Alternative Catalog Number: CSB-EP360792MO-1, CSB-EP360792MO-100, CSB-EP360792MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (H-2K(B))
Molecular Weight: 38.6 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P01901
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 22-305aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKE