Recombinant Chicken Riboflavin-binding protein, partial
Catalog Number:
CSB-EP360879CH
- Images (0)
| Article Name: | Recombinant Chicken Riboflavin-binding protein, partial |
| Biozol Catalog Number: | CSB-EP360879CH |
| Supplier Catalog Number: | CSB-EP360879CH |
| Alternative Catalog Number: | CSB-EP360879CH-1, CSB-EP360879CH-100, CSB-EP360879CH-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | , Riboflavin-binding protein, RBP) [Cleaved into: Riboflavin-binding protein, plasma form, Riboflavin-binding protein, yolk major form, Riboflavin-binding protein, yolk minor form] |
| Molecular Weight: | 27.8 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P02752 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 18-225aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | QQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLK |
Product Guarantee and Expert Support
