Recombinant Rat Alpha-1-acid glycoprotein (Orm1)
Catalog Number:
CSB-EP360882RAA0
- Images (0)
| Article Name: | Recombinant Rat Alpha-1-acid glycoprotein (Orm1) |
| Biozol Catalog Number: | CSB-EP360882RAA0 |
| Supplier Catalog Number: | CSB-EP360882RAa0 |
| Alternative Catalog Number: | CSB-EP360882RAA0-1, CSB-EP360882RAA0-100, CSB-EP360882RAA0-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Orosomucoid (OMD),CSB-PR2024 |
| Molecular Weight: | 25.7 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P02764 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 19-205aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP |
Product Guarantee and Expert Support
