Recombinant BK polyomavirus Major capsid protein VP1
Catalog Number:
CSB-EP360953BGYB1
- Images (0)
| Article Name: | Recombinant BK polyomavirus Major capsid protein VP1 |
| Biozol Catalog Number: | CSB-EP360953BGYB1 |
| Supplier Catalog Number: | CSB-EP360953BGYb1 |
| Alternative Catalog Number: | CSB-EP360953BGYB1-1, CSB-EP360953BGYB1-100, CSB-EP360953BGYB1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Major structural protein VP1 |
| Molecular Weight: | 45.1 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P03088 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-362aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MAPTKRKGECPGAAPKKPKEPVQVPKLLIKGGVEVLEVKTGVDAITEVECFLNPEMGDPDENLRGFSLKLSAENDFSSDSPERKMLPCYSTARIPLPNLNEDLTCGNLLMWEAVTVQTEVIGITSMLNLHAGSQKVHEHGGGKPIQGSNFHFFAVGGEPLEMQGVLMNYRSKYPDGTITPKNPTAQSQVMNTDHKAYLDKNNAYPVECWVPDPSRNENARYFGTFTGGENVPPVLHVTNTATTVLLDEQGVGPL |
Product Guarantee and Expert Support
