Recombinant Sindbis virus Non-structural polyprotein, partial
Catalog Number:
CSB-EP361019SHZ
- Images (0)
| Article Name: | Recombinant Sindbis virus Non-structural polyprotein, partial |
| Biozol Catalog Number: | CSB-EP361019SHZ |
| Supplier Catalog Number: | CSB-EP361019SHZ |
| Alternative Catalog Number: | CSB-EP361019SHZ-1, CSB-EP361019SHZ-100, CSB-EP361019SHZ-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (Non-structural polyprotein)(p270 nonstructural polyprotein)(Non-structural protein 4)(nsP4),CSB-PR2024 |
| Molecular Weight: | 60.4 kDa |
| Tag: | Tag-Free |
| UniProt: | P03317 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1348-1896aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | APSYRTKRENIADCQEEAVVNAANPLGRPGEGVCRAIYKRWPTSFTDSATETGTARMTVCLGKKVIHAVGPDFRKHPEAEALKLLQNAYHAVADLVNEHNIKSVAIPLLSTGIYAAGKDRLEVSLNCLTTALDRTDADVTIYCLDKKWKERIDAALQLKESVTELKDEDMEIDDELVWIHPDSCLKGRKGFSTTKGKLYSYFEGTKFHQAAKDMAEIKVLFPNDQESNEQLCAYILGETMEAIREKCPVDHNPS |
Product Guarantee and Expert Support
