Recombinant Enterobacteria phage lambda Holin (S), partial
Catalog Number:
CSB-EP361129FSF
- Images (0)
| Article Name: | Recombinant Enterobacteria phage lambda Holin (S), partial |
| Biozol Catalog Number: | CSB-EP361129FSF |
| Supplier Catalog Number: | CSB-EP361129FSF |
| Alternative Catalog Number: | CSB-EP361129FSF-1, CSB-EP361129FSF-100, CSB-EP361129FSF-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | (Lysis inhibitor S-107) |
| Molecular Weight: | 35.6 kDa |
| Tag: | N-terminal 6xHis-GST-tagged |
| UniProt: | P03705 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-37aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MKMPEKHDLLAAILAAKEQGIGAILAFAMAYLRGRYN |
Product Guarantee and Expert Support
