Recombinant Escherichia phage lambda Capsid decoration protein (D), partial
Catalog Number:
CSB-EP361132FSF1
- Images (0)
| Article Name: | Recombinant Escherichia phage lambda Capsid decoration protein (D), partial |
| Biozol Catalog Number: | CSB-EP361132FSF1 |
| Supplier Catalog Number: | CSB-EP361132FSF1 |
| Alternative Catalog Number: | CSB-EP361132FSF1-1, CSB-EP361132FSF1-100, CSB-EP361132FSF1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Auxiliary protein D Gene product D Major capsid protein D,CSB-PR2024 |
| Molecular Weight: | 32.5 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | P03712 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-56aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MTSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSRKLVAWDGTTDG |
Product Guarantee and Expert Support
