Recombinant Escherichia coli Type-1 fimbrial protein, A chain (fimA)
Catalog Number:
CSB-EP361210ENV
- Images (0)
| Article Name: | Recombinant Escherichia coli Type-1 fimbrial protein, A chain (fimA) |
| Biozol Catalog Number: | CSB-EP361210ENV |
| Supplier Catalog Number: | CSB-EP361210ENV |
| Alternative Catalog Number: | CSB-EP361210ENV-1, CSB-EP361210ENV-100, CSB-EP361210ENV-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Type-1A pilin |
| Molecular Weight: | 31.8 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | P04128 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 24-182aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ |
Product Guarantee and Expert Support
