Recombinant Human HLA class II histocompatibility antigen, DP beta 1 chain (HLA-DPB1),partial
Catalog Number:
CSB-EP361267HU
- Images (0)
| Article Name: | Recombinant Human HLA class II histocompatibility antigen, DP beta 1 chain (HLA-DPB1),partial |
| Biozol Catalog Number: | CSB-EP361267HU |
| Supplier Catalog Number: | CSB-EP361267HU |
| Alternative Catalog Number: | CSB-EP361267HU-1, CSB-EP361267HU-100, CSB-EP361267HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | HLA class II histocompatibility antigen, DP(W4) beta chain,MHC class II antigen DPB1 |
| Molecular Weight: | 26.8 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | P04440 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 30-223aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | RATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRN |
Product Guarantee and Expert Support
