Recombinant Enterobacteria phage T4 Recombination and repair protein (UVSX)
Catalog Number:
CSB-EP361289EDZ
- Images (0)
| Article Name: | Recombinant Enterobacteria phage T4 Recombination and repair protein (UVSX) |
| Biozol Catalog Number: | CSB-EP361289EDZ |
| Supplier Catalog Number: | CSB-EP361289EDZ |
| Alternative Catalog Number: | CSB-EP361289EDZ-1, CSB-EP361289EDZ-100, CSB-EP361289EDZ-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | UVSX,Recombination and repair protein |
| Molecular Weight: | 60 kDa |
| Tag: | N-terminal 6xHis-SUMO-tagged |
| UniProt: | P04529 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-391aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSDLKSRLIKASTSKLTAELTASKFFNEKDVVRTKIPMMNIALSGEITGGMQSGLLILAGPSKSFKSNFGLTMVSSYMRQYPDAVCLFYDSEFGITPAYLRSMGVDPERVIHTPVQSLEQLRIDMVNQLDAIERGEKVVVFIDSLGNLASKKETEDALNEKVVSDMTRAKTMKSLFRIVTPYFSTKNIPCIAINHTYETQEMFSKTVMGGGTGPMYSADTVFIIGKRQIKDGSDLQGYQFVLNVEKSRTVKEKS |
Product Guarantee and Expert Support
