Recombinant Human immunodeficiency virus type 1 group M subtype B Envelope glycoprotein gp160 (env), partial

Catalog Number: CSB-EP361302HKP
Article Name: Recombinant Human immunodeficiency virus type 1 group M subtype B Envelope glycoprotein gp160 (env), partial
Biozol Catalog Number: CSB-EP361302HKP
Supplier Catalog Number: CSB-EP361302HKP
Alternative Catalog Number: CSB-EP361302HKP-1, CSB-EP361302HKP-100, CSB-EP361302HKP-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Env polyprotein
Molecular Weight: 69.7 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: P04578
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 33-511aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNAKTIIV