Recombinant Mouse Major urinary protein 11 (Mup11)
Catalog Number:
CSB-EP361419MOB0
- Images (0)
| Article Name: | Recombinant Mouse Major urinary protein 11 (Mup11) |
| Biozol Catalog Number: | CSB-EP361419MOB0 |
| Supplier Catalog Number: | CSB-EP361419MOb0 |
| Alternative Catalog Number: | CSB-EP361419MOB0-1, CSB-EP361419MOB0-100, CSB-EP361419MOB0-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Mup9 |
| Molecular Weight: | 23.6 kDa |
| Tag: | N-terminal 10xHis-tagged |
| UniProt: | P04938 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-151aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE |
Product Guarantee and Expert Support
