Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b)
Catalog Number:
CSB-EP361472ARW
- Images (0)
| Article Name: | Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b) |
| Biozol Catalog Number: | CSB-EP361472ARW |
| Supplier Catalog Number: | CSB-EP361472ARW |
| Alternative Catalog Number: | CSB-EP361472ARW-1, CSB-EP361472ARW-100, CSB-EP361472ARW-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | ns3b,Accessory protein 3b,CSB-PR2024 |
| Molecular Weight: | 8.4 kDa |
| Tag: | C-terminal 6xHis-tagged |
| UniProt: | P05138 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-64aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MLNLEAIIETGEQVIQKISFNLQHISSVLNTEVFDPFDYCYYRGGNFWEIESAEDCSGDDEFIE |
Product Guarantee and Expert Support
