Recombinant Human Protein MEMO1 (MEMO1)
Catalog Number:
CSB-EP896500HU
- Images (0)
| Article Name: | Recombinant Human Protein MEMO1 (MEMO1) |
| Biozol Catalog Number: | CSB-EP896500HU |
| Supplier Catalog Number: | CSB-EP896500HU |
| Alternative Catalog Number: | CSB-EP896500HU-1, CSB-EP896500HU-100, CSB-EP896500HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | C21orf19-like protein Hepatitis C virus NS5A-transactivated protein 7 |
| Molecular Weight: | 60.7 kDa |
| Tag: | N-terminal GST-tagged |
| UniProt: | Q9Y316 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-297aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MSNRVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTICGRHPIGVLLN |
Product Guarantee and Expert Support
