Recombinant Human C-C chemokine receptor type 4 (CCR4)-VLPs (Active)
Catalog Number:
CSB-MP004843HU
- Images (0)
| Article Name: | Recombinant Human C-C chemokine receptor type 4 (CCR4)-VLPs (Active) |
| Biozol Catalog Number: | CSB-MP004843HU |
| Supplier Catalog Number: | CSB-MP004843HU |
| Alternative Catalog Number: | CSB-MP004843HU-1, CSB-MP004843HU-100, CSB-MP004843HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | K5-5 CD_antigen: CD194 |
| Molecular Weight: | 43.2 kDa |
| Tag: | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) |
| UniProt: | P51679 |
| Buffer: | Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Source: | Mammalian cell |
| Expression System: | 1-360aa |
| Purity: | The purity information is not available for VLPs proteins. |
| Form: | Lyophilized powder |
| Sequence: | MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVVVLVLFKYKRLRSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVGFYSGIFFVMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYTERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTLQHCKNEKKNKAVKMIFAVVVLFLGFW |
Product Guarantee and Expert Support
