Recombinant Mouse Dipeptidase 3 (Dpep3)
Catalog Number:
CSB-MP007125MO
- Images (0)
| Article Name: | Recombinant Mouse Dipeptidase 3 (Dpep3) |
| Biozol Catalog Number: | CSB-MP007125MO |
| Supplier Catalog Number: | CSB-MP007125MO |
| Alternative Catalog Number: | CSB-MP007125MO-1, CSB-MP007125MO-100, CSB-MP007125MO-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Membrane-bound dipeptidase 3,MBD-3,Protein expressed in male leptotene and zygotene spermatocytes 136,MLZ-136 |
| Molecular Weight: | 48.7 kDa |
| Tag: | C-terminal 10xHis-tagged |
| UniProt: | Q9DA79 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 36-462aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | TCTLTTPSPSSAPTTPEASNATTAPGIPNDTATSGVTSDPRLREQALALMRDFPLVDGHNDLPLLLRELFQNQLQDVNLRNFTRGQTNLDRLRDGLVGAQFWSAYIPCQTQDRDAVRLALEQIDLIRRMCSAYPELELVTSADGLNNTQKLACLIGVEGGHSLDTSLAVLRSFYELGVRYLTLTFTCSTPWAESATKFRHHFYTNISGLTSFGEKVVEEMNRLGMMIDLSHASDTLVKQTLEVSQAPVIFSHSAA |
Product Guarantee and Expert Support
