Recombinant Human Tumor necrosis factor receptor superfamily member 4 (TNFRSF4), partial

Catalog Number: CSB-MP023981HU1
Article Name: Recombinant Human Tumor necrosis factor receptor superfamily member 4 (TNFRSF4), partial
Biozol Catalog Number: CSB-MP023981HU1
Supplier Catalog Number: CSB-MP023981HU1
Alternative Catalog Number: CSB-MP023981HU1-1, CSB-MP023981HU1-100, CSB-MP023981HU1-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (ACT35 antigen)(OX40L receptor)(TAX transcriptionally-activated glycoprotein 1 receptor)(CD antigen CD134),CSB-PR2024
Molecular Weight: 49.3 kDa
Tag: C-terminal hFc-Myc-tagged
UniProt: P43489
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 29-216aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA