Recombinant Human Tumor necrosis factor receptor superfamily member 8(TNFRSF8), partial (Active)
Catalog Number:
CSB-MP023983HU1
- Images (0)
| Article Name: | Recombinant Human Tumor necrosis factor receptor superfamily member 8(TNFRSF8), partial (Active) |
| Biozol Catalog Number: | CSB-MP023983HU1 |
| Supplier Catalog Number: | CSB-MP023983HU1 |
| Alternative Catalog Number: | CSB-MP023983HU1-1, CSB-MP023983HU1-100, CSB-MP023983HU1-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Molecular Weight: | 43.5 kDa |
| Tag: | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| UniProt: | P28908 |
| Buffer: | Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Source: | Mammalian cell |
| Expression System: | 19-379aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTP |
Product Guarantee and Expert Support
