Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial

Product Overview

• Article Name: Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial
• Biozol Catalog Number: CSB-MP023986HU(F2)
• Supplier Catalog Number: CSB-MP023986HU(F2)
• Alternative Catalog Number: CSB-MP023986HU(F2)-1, CSB-MP023986HU(F2)-100, CSB-MP023986HU(F2)-20
• Manufacturer: Cusabio
• Category: Proteine/Peptide
• Alternative Names: Osteoclast differentiation factor,ODF,Osteoprotegerin ligand,OPGL,Receptor activator of nuclear factor kappa-B ligand,RANKL,TNF-related activation-induced cytokine,TRANCE,CD254,CSB-PR2024

Product Properties

• Molecular Weight: 22.7 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: O14788
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mammalian cell
• Expression System: 63-244aa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID