Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9), partial, Biotinylated
Catalog Number:
CSB-MP023997HU-B
- Images (0)
| Article Name: | Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9), partial, Biotinylated |
| Biozol Catalog Number: | CSB-MP023997HU-B |
| Supplier Catalog Number: | CSB-MP023997HU-B |
| Alternative Catalog Number: | CSB-MP023997HU-B-1, CSB-MP023997HU-B-100, CSB-MP023997HU-B-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | 4-1BB ligand,4-1BBL |
| Molecular Weight: | 50.6 kDa |
| Tag: | C-terminal hFc-Avi-tagged |
| UniProt: | P41273 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mammalian cell |
| Expression System: | 50-254aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
Product Guarantee and Expert Support
